PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g114860.1
Common NameMTR_7g114860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Trihelix
Protein Properties Length: 484aa    MW: 55781.3 Da    PI: 6.7997
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g114860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.42e-09121177261
         trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkry 61 
                      Wt++e l+L ++++ +++ + ++      W++vs+k++e g+++s++ Ckek+e  n  +
  Medtr7g114860.1 121 WTNHELLVLFKITSTIHNFFPDQ---LITWDHVSSKLAELGIKKSAQNCKEKFEHENASF 177
                      *****************999987...789*************************988766 PP

2trihelix91.49.7e-29381474186
         trihelix   1 rWtkqevlaLiearr......emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikeg..ekkrtsessstcpyfdqle 86 
                      rW+++evlaLi++++      + +++++ ++ k+plWe++s+ m e g++rs+k+Ckekwen+nk++kk+k++  +kk++s +s+tcpyf+ql 
  Medtr7g114860.1 381 RWPRDEVLALINLKSttsvinRSNNNVEGNSNKGPLWERISEGMFELGYKRSAKRCKEKWENINKYFKKTKDIvvNKKKRSMDSRTCPYFHQLS 474
                      8**************665443334444446799***************************************7447777899**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071778117176IPR001005SANT/Myb domain
PROSITE profilePS500905.204119171IPR017877Myb-like domain
SMARTSM007170.0037378446IPR001005SANT/Myb domain
PfamPF138377.6E-19379475No hitNo description
PROSITE profilePS500907.015379444IPR017877Myb-like domain
CDDcd122032.28E-24380451No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MHVEYSSRAA LVALANMLDE GEHFEFEQLS STTTTSLLPS SSSSSSVANI NNTFHHIPLI  60
PSTSTSNSHD QFPLQTQINL FHPSILSLPH HSPNTTTFNS NSNSINFQIQ IPPPLIIDSS  120
WTNHELLVLF KITSTIHNFF PDQLITWDHV SSKLAELGIK KSAQNCKEKF EHENASFFPR  180
FVSELQDLYQ GGGFSVDENT QLEEDDRLET KQCDDDDDKV RMEKSKNKKR KRRRDRFEML  240
KSFCETVVNK IIAQQEEIHN KLLEDMLKRD QEKLDREETW KKQEIERMNM MVQEQQAIAS  300
DRQANIIEFL NKYLATGYSS SSSTQLHPQN PNNPSNNLES KTPFSNVIAD QNPSSSDTEY  360
SNSTSTLVVP TIMEKLEDRR RWPRDEVLAL INLKSTTSVI NRSNNNVEGN SNKGPLWERI  420
SEGMFELGYK RSAKRCKEKW ENINKYFKKT KDIVVNKKKR SMDSRTCPYF HQLSSLYNQQ  480
QEK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227232KKRKRR
2227233KKRKRRR
3228233KRKRRR
4229233RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626419.10.0Myb/SANT-like DNA-binding domain protein
SwissprotQ8H1811e-64GTL2_ARATH; Trihelix transcription factor GTL2
TrEMBLG7L1T90.0G7L1T9_MEDTR; Myb/SANT-like DNA-binding domain protein
STRINGGLYMA19G43280.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.11e-56Trihelix family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]